The domain within your query sequence starts at position 10 and ends at position 96; the E-value for the DUF4500 domain shown below is 1.1e-43.
VKKEPLKEKNFENPGLRGAHTTTLFRAVNPELFIKPNKPVMAFGLVTLSLCVAYIGYLHA TQENRKDLYEAIDSEGHRYMRRKTSKW
DUF4500 |
---|
PFAM accession number: | PF14937 |
---|---|
Interpro abstract (IPR026686): | This entry consists of uncharacterised, single-pass membrane proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4500