The domain within your query sequence starts at position 20 and ends at position 199; the E-value for the DUF4501 domain shown below is 1e-109.
STESQAQQPECCMDVVDFNATCLGTGLCGPGCYRHWNADGSASCVRCWNGTLPTYNGSEC RILTGRGVQLPMNRSTGTPGQPHFGGPHVAASLFLGTLFISTGLILSVAGFFYLKRSSKL PEVFYRRDRAPVLQPGETAAMVPLPQSSVRKPRYIRREQHPDKNRDPSAFSTVEAHISNV
DUF4501 |
---|
PFAM accession number: | PF14946 |
---|---|
Interpro abstract (IPR027888): | This family of proteins is found in eukaryotes. The exact function of the family members remains unknown, but they are thought to be a single-pass membrane proteins. This family contains many highly conserved cysteine residues. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4501