The domain within your query sequence starts at position 49 and ends at position 167; the E-value for the DUF4501 domain shown below is 7.7e-69.

PVTGRGVQLPMNRSTGTPGQPHFGGPHVAASLFLGTLFISTGLILSVAGFFYLKRSSKLP
EVFYRRDRAPVLQPGETAAMVPLPQSSVRKPRYIRREQHPDKNRDPSAFSTVEAHISNV

DUF4501

DUF4501
PFAM accession number:PF14946
Interpro abstract (IPR027888):

This family of proteins is found in eukaryotes. The exact function of the family members remains unknown, but they are thought to be a single-pass membrane proteins. This family contains many highly conserved cysteine residues.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4501