The domain within your query sequence starts at position 37 and ends at position 136; the E-value for the DUF4508 domain shown below is 1.7e-41.
TSQEMKCILYWFASWSGPQRERFLQDLVAKAVPGKLQPLLDALEQLSMSAANRPPCIFEC QLRLWDQWFRGWAEQERNEFVRQLEVSEPDFVAKFYQAVA
DUF4508 |
 |
|---|
| PFAM accession number: | PF14969 |
|---|---|
| Interpro abstract (IPR028019): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 117 and 253 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4508