The domain within your query sequence starts at position 40 and ends at position 138; the E-value for the DUF4509 domain shown below is 4.1e-32.
DRPEAAPVLWQLLLRVLSPLAANNTWTDLAPEAQACVVKSALGSQGYPRSVLLQFPDGSS QGSRELLLALSWLLARGPLLEQLLAQTRVQLGDQLPQWE
DUF4509 |
---|
PFAM accession number: | PF14970 |
---|---|
Interpro abstract (IPR027996): | This domain is found in eukaryotic sequences. It contains a conserved WLL sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4509