The domain within your query sequence starts at position 1 and ends at position 72; the E-value for the DUF4513 domain shown below is 2.7e-29.
DDGPALPKLDDDNQTAENTCKPAEEQPQQLRWDDIHLPRFSLKQGMIPTRYVMPWKENMK FRNVNLQVLSHK
DUF4513 |
 |
|---|
| PFAM accession number: | PF14983 |
|---|---|
| Interpro abstract (IPR027965): | This family of uncharacterised proteins is found in metazoans. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4513