The domain within your query sequence starts at position 16 and ends at position 75; the E-value for the DUF4514 domain shown below is 3.6e-40.

GIGGAQVLATGKPAETEIDFKYAIIGMAVGVAISAGFLALKICMIRRHLSDNDSADLKNT

DUF4514

 DUF4514
PFAM accession number:PF14986
Interpro abstract (IPR029395):

This family of uncharacterised proteins are found in mammals, including TMEM273 from humans.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4514