The domain within your query sequence starts at position 202 and ends at position 407; the E-value for the DUF4515 domain shown below is 2e-77.

EKNCFLRVLRKQSEQCKKKHGQLWNQYVQDLGEIIRRKQELTLRFAKQTEELQTQLFQGK
IKQSQLEQQFQSMEHISSIQKSQEMKIQMLEKELEDVKAETARKDHQAHLQFLQRKTHLM
RQIQELRSLQAGDHNTPEVRQKAQLFKSTAKKVNSEYCRSVCRENQELQEDLLKLIQEYY
KLESIKRKLEMCKERLKEEQCYQEAL

DUF4515

DUF4515
PFAM accession number:PF14988
Interpro abstract (IPR032777):

This domain contains two completely conserved L residues that may be functionally important. Proteins with this domain include basal body-orientation factor 1 (bbof1), and coiled-coil domain-containing protein 166 and 121. Bbof1 is required to maintain cilia orientation [(PUBMED:23900544)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4515