The domain within your query sequence starts at position 1 and ends at position 46; the E-value for the DUF4516 domain shown below is 1.5e-29.
MPGGVPWSAYLKMLSSSLLAMCAGAQVVHWYYRPDLTIPEIPPKPG
DUF4516 |
 |
|---|
| PFAM accession number: | PF14990 |
|---|---|
| Interpro abstract (IPR027858): | BRAWNIN is essential for respiratory chain complex III (CIII) assembly [ (PUBMED:32161263) ]. |
| GO process: | mitochondrial respiratory chain complex III assembly (GO:0034551) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4516