The domain within your query sequence starts at position 4 and ends at position 274; the E-value for the DUF4518 domain shown below is 1.8e-111.

LSHLESEGCRNLLGLLDNDEIMALCDTVTNRLVQPVDRQDAIHAILVYSQNVEELLRRKK
VHREVIFKYLAKQGVVVPPTAEKHNLIQYAKDYWAKQSPKLKDTAEPVTKTEDIQLFKQQ
AKEDKEAEKVDFRRLGEEFCHWFFELLNSQNPFLGPPQDDWGPQHFWHDAKLRFYYNTSE
QNTTDYQGAEIVSLRLLSLVKEEFLFLSPNLDSQGLKCASSPHGLVMVGVAGTVHRGNSC
LGIFEQIFGLIRSPFVENTWKIKFINLRIIG

DUF4518

DUF4518
PFAM accession number:PF15008
Interpro abstract (IPR026698): Proteins in this family are not characterised. They might be involved in apoptosis regulation [(PUBMED:17464193)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4518