The domain within your query sequence starts at position 1 and ends at position 56; the E-value for the DUF4519 domain shown below is 7.1e-31.

MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPA

DUF4519

• PFAM accession number: PF15012
• Interpro abstract (IPR027960):

  Proteins in this family contain two conserved sequence motifs, KET and VLP, and a single completely conserved residue P that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4519