The domain within your query sequence starts at position 1 and ends at position 156; the E-value for the DUF4521 domain shown below is 6e-80.

MESQAATPSSLSGESCTLDLPAVCDTSSYEASQRVSQGSSNSLSSLESHPFLSSSTTDPD
SNSLNTEQKGSWDSENFWLDPSSKGQLETNEEEDGLRKSLDRFYEAFAHPLPGSGDPLSA
SVCQCLSQTISELEGQESQRYALRSFQMAQVIFSRD

DUF4521

DUF4521
PFAM accession number:PF15021
Interpro abstract (IPR027821):

This family of vertebrate proteins is functionally uncharacterised. The family includes the chromosome 20 protein C20orf196.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4521