The domain within your query sequence starts at position 1 and ends at position 206; the E-value for the DUF4521 domain shown below is 2.3e-110.
MESQAATPSSLSGESCTLDLPAVCDTSSYEASQRVSQGSSNSLSSLESHPFLSSSTTDPD SNSLNTEQKGSWDSENFWLDPSSKGQLETNEEEDGLRKSLDRFYEAFAHPLPGSGDPLSA SVCQCLSQTISELEGQESQRYALRSFQMAQVIFSRDGCSILQRHSRDTRFYPLEQEGSSV DDEEPTPGLSREVIRFLLEQTVMKDS
DUF4521 |
![]() |
---|
PFAM accession number: | PF15021 |
---|---|
Interpro abstract (IPR027821): | SHLD1, also known as RINN3, is a component of the shieldin complex, a vertebrate-specific protein complex which functions as a downstream effector in the 53BP1 pathway, regulates NHEJ (non-homologous end joining) [ (PUBMED:29656893) ]. |
GO process: | regulation of double-strand break repair via nonhomologous end joining (GO:2001032) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4521