The domain within your query sequence starts at position 5 and ends at position 120; the E-value for the DUF4530 domain shown below is 1.8e-59.
MEPWVQLKQAGLEPSGLGPLPKALRVPPPEGNPGQALMSSGAELGGARELILWIWEELGN LRRVDVQLLGQLCDLGLEMGTFREELVTILEEEEEEEEQEEKSCVEENKGPEEKQD
DUF4530 |
---|
PFAM accession number: | PF15039 |
---|---|
Interpro abstract (IPR029202): | This family of proteins is found in eukaryotes. Proteins in this family are typically around 140 amino acids in length. The human member of this family is C19orf69. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4530