The domain within your query sequence starts at position 1 and ends at position 128; the E-value for the DUF4531 domain shown below is 2.6e-47.
XEPGDAWYKLPRALDTPYREAHTRWHGCFQSRQRGLPPAYTQHLREMAFWDPAITAQYLN SGPRWGCMQWRDRQIRGKEFAAALHRAGLQTAGPAAALPGHRPASSGFHTRALIKPCYRP VCPCPRKP
DUF4531 |
---|
PFAM accession number: | PF15041 |
---|---|
Interpro abstract (IPR029203): | This family of uncharacterised proteins is found in mammals. This family includes the human protein C19orf71. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4531