The domain within your query sequence starts at position 45 and ends at position 91; the E-value for the DUF4536 domain shown below is 2.2e-23.

TCWSCRVLSGSTLFGAGTYVYLVARRPLKQGIPPGPGTVLQMVIGIS

DUF4536

• PFAM accession number: PF15055
• Interpro abstract (IPR028036):

  This domain is thought to be a transmembrane helix. It is found in eukaryotes, and is approximately 50 amino acids in length. In humans, it is located in protein C9orf123.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4536