The domain within your query sequence starts at position 4 and ends at position 60; the E-value for the DUF4538 domain shown below is 6.8e-33.

ARNLRTALIFGGFISMVGAAFYPIYFRPLMRLEEYQKEQAVNRAGIVQEDVQPPGLK

DUF4538

DUF4538
PFAM accession number:PF15061
Interpro abstract (IPR027917):

SMIM20, also known as MITRAC7, acts as a COX1-specific chaperone and is required for cytochrome c oxidase biogenesis [ (PUBMED:26321642) ].

GO process:mitochondrial cytochrome c oxidase assembly (GO:0033617)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4538