The domain within your query sequence starts at position 4 and ends at position 60; the E-value for the DUF4538 domain shown below is 6.8e-33.
ARNLRTALIFGGFISMVGAAFYPIYFRPLMRLEEYQKEQAVNRAGIVQEDVQPPGLK
DUF4538 |
---|
PFAM accession number: | PF15061 |
---|---|
Interpro abstract (IPR027917): | SMIM20, also known as MITRAC7, acts as a COX1-specific chaperone and is required for cytochrome c oxidase biogenesis [ (PUBMED:26321642) ]. |
GO process: | mitochondrial cytochrome c oxidase assembly (GO:0033617) |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4538