The domain within your query sequence starts at position 457 and ends at position 542; the E-value for the DUF4539 domain shown below is 3.2e-34.

RNKVPNMAVMIKSLTRSTMDASVVFKDPTGEMLGTVHRVLLETHQSELRPGSVLLLKQIG
VFSPSLRNHYLNVTPNNLVHIYSLDS

DUF4539

DUF4539
PFAM accession number:PF15072
Interpro abstract (IPR028045):

This family of proteins is found in eukaryotes. Proteins in this family are typically between 230 and 625 amino acids in length.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4539