The domain within your query sequence starts at position 90 and ends at position 217; the E-value for the DUF4540 domain shown below is 2.5e-67.

YPPPYGRAYPLAPLRDDVPLGDPCSGFMSPGGDANLKPNIGRAIPNLVSFHDVKPQNRVP
RPDKGFQTTIKRQTILAEELKQDRRWNSRKVPDISIKAKLGGWTSPMKVVPVPVHEHEVG
TLSRIYTF

DUF4540

DUF4540
PFAM accession number:PF15073
Interpro abstract (IPR027867):

Spermatogenesis-associated protein 48 is also known as post-meiotic spermatogenesis protein 1 [(PUBMED:22110678)]. Proteins in this family are typically between 109 and 302 amino acids in length. In humans, it is found in the chromosomal position, C7orf72.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4540