The domain within your query sequence starts at position 77 and ends at position 168; the E-value for the DUF4541 domain shown below is 1.2e-42.
SYFSREGQTGIVSLYDCVFKRRLDYNQKLHRDDREHAKNLGLHINEEEQERTVPVLMSSV YGKRINQPIEPLNRDYGHVSHVKTDFYRKNEI
DUF4541 |
 |
|---|
| PFAM accession number: | PF15074 |
|---|---|
| Interpro abstract (IPR027901): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 100 and 163 amino acids in length. There is a conserved KLHRDDR sequence motif and a single completely conserved residue Y that may be functionally important. In humans, the gene is found in the chromosomal location, C5orf49. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4541