The domain within your query sequence starts at position 17 and ends at position 181; the E-value for the DUF4548 domain shown below is 1.9e-89.
PWLSEASLVNKPLILSIPRRYHSSFVLTSYKKDMYLPHLLENPDFLSKARKNEHENLSPR NKQLCATCRGYQKVKTVQPKTFIIPDHQKPPSQNSVNHREVSLHSQVQQLNSYNDIPTES ISYRLPILGPRTAVFHRLLSSAYENPRDTQHRAFPRKKGMSKTVK
DUF4548 |
---|
PFAM accession number: | PF15081 |
---|---|
Interpro abstract (IPR027845): | This family of proteins is found in eukaryotes. The human member of this family is C1orf105. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4548