The domain within your query sequence starts at position 2 and ends at position 145; the E-value for the DUF4549 domain shown below is 7.9e-74.

DSVYKFSSTERIVLLEKELAVKLSELKTEVEDQGLFPGTGNRIFSSVQIPKDVAHFRRER
EAALKRTLQVAESKPLVIQADVLKRELESCLRREYTPENLPLLLLQYYTERITQLGQSKY
LHVLRWKRLCQTSMAMEELYPLYK

DUF4549

DUF4549
PFAM accession number:PF15082
Interpro abstract (IPR029376):

This entry represents a group of eukaryotic proteins that are typically between 143 and 1871 amino acids in length. The human member of this family is C6orf183.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4549