The domain within your query sequence starts at position 1 and ends at position 148; the E-value for the DUF4551 domain shown below is 3.6e-66.
AFLRRHLPPEVYDAVRAYEPCIVVSDAEKHTFKYVVLSDRLIYLTENPPKSIRRVVALRD VVAIDLIDDYPEFLSSPDREINQHIRIVYSSTVLKKERGKSKGVGKFLFPAHHSTANKKV KQENNGPTFWRRKVSRTLNESSLRSEEK
DUF4551 |
---|
PFAM accession number: | PF15087 |
---|---|
Interpro abstract (IPR027878): | This metazoan family of proteins is functionally uncharacterised. This family includes human protein C12orf56. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4551