The domain within your query sequence starts at position 2 and ends at position 65; the E-value for the DUF4560 domain shown below is 1.6e-43.
ATALSGLAVRLSRSAAARSYGVFCKGLTRTLLIFFDLAWRLRINFPYLYIVASMMLNVRL QVHI
DUF4560 |
 |
|---|
| PFAM accession number: | PF15118 |
|---|---|
| Interpro abstract (IPR029367): | The function of small integral membrane protein 10 (SMIM10) is not clear. There are two conserved sequence motifs: FCK and RTL. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4560