The domain within your query sequence starts at position 1 and ends at position 57; the E-value for the DUF4564 domain shown below is 1.1e-13.

MYMQVETRTSTRLHLKRAPGIRSWSLLVGDHGFPSFLFPGSDLFISALSLFLHRCLS

DUF4564

DUF4564
PFAM accession number:PF15169
Interpro abstract (IPR027846):

This family of proteins is functionally uncharacterised. It is found in eukaryotes and includes the human protein C17orf62.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4564