The domain within your query sequence starts at position 10 and ends at position 167; the E-value for the DUF4566 domain shown below is 1.6e-102.
SPVVRKKKSALFEVSEVIPVMTNNYEENILKGVRDSSYSLESSLELLQKDVVQLHAPRYQ SMRRDVIGCTQEMDFILWPRNDIEKIVCLLFSRWKESDEPFRPVQAKFEFHHGDYEKQFL HVLSRKDKTGIVVNNPNQSVFLFIDRQHLQTPKNKATI
DUF4566 |
---|
PFAM accession number: | PF15130 |
---|---|
Interpro abstract (IPR027903): | This family of proteins is functionally uncharacterised. This family of proteins is found in eukaryotes and includes human protein C6orf62. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4566