The domain within your query sequence starts at position 23 and ends at position 188; the E-value for the DUF4568 domain shown below is 7.2e-90.
RSIHRKWKGSFQTFGKDVCITGQSVSSGLRTVPQEYACCQCYTKFGGHLPVPRADALLPY WVPLSLRPRKQVSKMMRCYIPRAMKSCRCSCHCFGGRLPMPRDRAVMPYWVPQGLRSQKK VLKRLENVEDTPGRPQDSSRWYGCWRVCGNQHLLLKWQQLQALYQD
DUF4568 |
---|
PFAM accession number: | PF15132 |
---|---|
Interpro abstract (IPR027919): | This family of proteins is functionally uncharacterised. This family of proteins is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4568