The domain within your query sequence starts at position 3 and ends at position 48; the E-value for the DUF4568 domain shown below is 2.1e-6.

GAGLQAWLYPGRVRFRPLERMCASRVSRCPPASALFPRSMRVANAT

DUF4568

DUF4568
PFAM accession number:PF15132
Interpro abstract (IPR027919):

This family of proteins is functionally uncharacterised. This family of proteins is found in eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4568