The domain within your query sequence starts at position 1 and ends at position 110; the E-value for the DUF4570 domain shown below is 1.1e-48.
MASLFTQEIHLSKRHEEILSQRLMLLQKMKNKFGDENTERASLLQATETASRRNLRLLKD IDAAEEAFQTKLIPHPQPSMLSLETRYWASVEEHIPKWELFLLGRAPYPI
DUF4570 |
 |
|---|
| PFAM accession number: | PF15134 |
|---|---|
| Interpro abstract (IPR028006): | This family of proteins is functionally uncharacterised. This family of proteins is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4570