The domain within your query sequence starts at position 19 and ends at position 136; the E-value for the DUF4571 domain shown below is 4.1e-66.
MTSPSSFCLLLLQALGIVALGHFTKAQNNTLIFTKGNTIRNCSCPVDIRDCDYSLANLIC SCKSILPSAMEQTSYHGHLTIWFTDISTLGHVLKFTLVQDLKLSLCGSSTFPTKYLAI
DUF4571 |
---|
PFAM accession number: | PF15137 |
---|---|
Interpro abstract (IPR029250): | This family of proteins is functionally uncharacterised. This family is found in vertebrates and includes human protein C21orf62. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4571