The domain within your query sequence starts at position 15 and ends at position 140; the E-value for the DUF4578 domain shown below is 1.7e-61.
MGNRLCCGGTWSCPSTFQKKSKTGSHPRPTLSILKQQQLWQNGTKDYETTAPTYEQVLYP PASQKKTSNSTSEESDLHYADIHVLRQIRPHSLHTVKCLHSESATEYATLRFPQATPQYD SNNGTL
DUF4578 |
---|
PFAM accession number: | PF15147 |
---|---|
Interpro abstract (IPR028106): | This family of proteins is found in eukaryotes and includes human protein C11orf52. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4578