The domain within your query sequence starts at position 383 and ends at position 820; the E-value for the DUF4584 domain shown below is 9.7e-162.

PPSVQAQANFLYHLASAAAATKPAAFEDAGRLPDLKSSVKAESPEEWSLQSWAPKGTPVY
CPASLGSCFPEIRNDRVSEITFPHSEISSTVKRTDLTINCHAEGASSPSPKTNNVFPQQR
ILREARKCLQATPTTHCAENSTIAARFLNNDSCGTTANSGKDSKIPHCPEFATDLPSLQS
DPRVDTATAAAAAAAATKAESLCTGTGDKTLPFLHNIKIKVEDSSANEEYEPELITNKLK
WECNDAEGEFYNMTEKKEEDALVPTAKEGFACPEKETPSLNPLAQSQGLSCTLGSPKPED
GEYKFGARVRKNYRTLVLGKRPVLQTPPVKPNLKSARSPRPTGKTETHEGTLDDFTVLNR
RKKVASNVASAVKRPFNFMANFPCPPSLIIGKDGDLWPAYSLNTTKDSQPPHKAHPIWKW
QLGGSAIPLPPSHKFRKF

DUF4584

DUF4584
PFAM accession number:PF15223
Interpro abstract (IPR027971):

In mouse embryonic stem cells (mESCs), the transcriptional network can be divided into three functionally distinct modules: Polycomb, Core, and Myc, and the Polycomb module represses developmental genes [(PUBMED:27863226)]. This family includes the polycomb repressive complex 2-associated factor EPOP (Elongin BC and Polycomb Repressive Complex 2 (PRC2) Associated Protein, also termed C17orf96, esPRC2p48, E130012A19Rik), a scaffold protein expressed in the inner cell mass of the mouse blastocyst serving as a bridging partner between the PRC2/EED-EZH2 complex and the elongin BC complex, and fine-tuning the transcriptional status of Polycomb group (PcG) target genes in embryonic stem cells. Both EPOP and Elongin BC are required to maintain low levels of expression at PRC2 genomic targets [(PUBMED:27863225)]. EPOP interacts with the H2B deubiquitinase USP7 to modulate transcriptional processes in mESCs similar to MYC [(PUBMED:27863226)].

Another member of the family is the uncharacterized SKI/DACH domain-containing protein 1.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4584