The domain within your query sequence starts at position 39 and ends at position 101; the E-value for the DUF4587 domain shown below is 1.5e-18.

QHNRVKEDLLELMMLQNAQMHQLLLGQLVADALNPGPEWPSPPERCAPTPTPQCNGDCWC
RCT

DUF4587

DUF4587
PFAM accession number:PF15248
Interpro abstract (IPR027904):

This entry represents a domain of unknown function. This domain is found in eukaryotes, and is typically between 64 and 79 amino acids in length. It contains two conserved sequence motifs: QNAQ and HHH.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4587