The domain within your query sequence starts at position 53 and ends at position 304; the E-value for the DUF4589 domain shown below is 4.4e-80.

EVVDQIDTLTSDLQLEDEMTDSSKTDTLNSSSSGTTASSIEKIKEQANAPLIKPPAHPSA
ILTVLRKPNPPPPPPRLTPVRCEEPQRVVPTANPVKTNGTLLRNGGLAGRPNKIPNGDIC
CIPNSNLDKAPLQSLMHRPEKDRSPQAGPRERVRFNEKVQYHGYCPDCESRYNIKNREVH
LHSEPVHPPGKIPHQGPLLHPPPHLPNFPLENGGLGISHSNSFPPPTPATVPPPAAPKPQ
KTILRKSTTTTV

DUF4589

DUF4589
PFAM accession number:PF15252
Interpro abstract (IPR027997):

This protein family is of unknown function. This family of proteins is found in eukaryotes and are typically between 215 and 293 amino acids in length. The proteins contain two conserved sequence motifs: SSS and KST.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4589