The domain within your query sequence starts at position 648 and ends at position 767; the E-value for the DUF4591 domain shown below is 7.2e-38.

KLGGLGPDFASVRDKMQMLMQQKEYAQQVKDYNMKALSILSKPQTSKTESKSAISRKKAL
DYAKTIPKPKPPNLPDQTAKKTKNSRHSEKEGGLPEISLLEILQSRHEREKQAVAAFKVL

DUF4591

DUF4591
PFAM accession number:PF15261
Interpro abstract (IPR027968):

Jhy protein is the protein product of the gene Jhy (previously known as 4931429I11Rik). This protein family is found in eukaryotes. In humans, the gene encoding this protein lies in the position chromosome 11 open reading frame 63. The function of Jhy protein is still to be determined.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4591