The domain within your query sequence starts at position 130 and ends at position 243; the E-value for the DUF4592 domain shown below is 1.8e-33.

CNVKMGPPPPGGLPIKRAEETGMSSEDDGLPRSPPEMSLLHDVGPGTTIKILVSSSRPQS
PDHMSDASISSRTLDGSLAPVVDFSHPPEFSSCLDNSAAKHKLLVKPRNQRSSK

DUF4592

DUF4592
PFAM accession number:PF15262
Interpro abstract (IPR028030):

This domain of unknown function lies to the N terminus of the protein. This domain is found in eukaryotes and contains two completely conserved residues (L and A) that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4592