The domain within your query sequence starts at position 1053 and ends at position 1098; the E-value for the DUF4596 domain shown below is 4.1e-27.
ELGRWAELLSPLDESRASITSVTSFSPDDVASPQGDWTVVEVETFH
DUF4596 |
---|
PFAM accession number: | PF15363 |
---|---|
Interpro abstract (IPR027907): | This domain is found in vertebrates. It is found at the C terminus of some uncharacterised proteins. It contains a conserved ELET sequence motif and two completely conserved residues (S and E) that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4596