The domain within your query sequence starts at position 54 and ends at position 181; the E-value for the DUF4600 domain shown below is 1.8e-58.

AGSEWKTRYETQLELNDQLEKQIVSLKEKMEKMRGNPSDRLSSIRVYEKMPVESLNVLLK
QLEKEKRSLESQVKEYAFRLEQESKAYHRTNNERRSYIAEMTQVSGSNQVSKRQQMDPLP
RMKESPVK

DUF4600

DUF4600
PFAM accession number:PF15372
Interpro abstract (IPR028022): Some members of this family are also annotated as coiled-coil domain-containing protein 169 (CCDC169).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4600