The domain within your query sequence starts at position 54 and ends at position 181; the E-value for the DUF4600 domain shown below is 1.8e-58.
AGSEWKTRYETQLELNDQLEKQIVSLKEKMEKMRGNPSDRLSSIRVYEKMPVESLNVLLK QLEKEKRSLESQVKEYAFRLEQESKAYHRTNNERRSYIAEMTQVSGSNQVSKRQQMDPLP RMKESPVK
DUF4600 |
---|
PFAM accession number: | PF15372 |
---|---|
Interpro abstract (IPR028022): | Some members of this family are also annotated as coiled-coil domain-containing protein 169 (CCDC169). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4600