The domain within your query sequence starts at position 23 and ends at position 81; the E-value for the DUF4603 domain shown below is 2.4e-37.

GPVSVSDMSLLHALGPVQTWLGQELEKCGIDAMIYSRYILSLLLHDSYDYDLQEQVGID

DUF4603

 DUF4603
PFAM accession number:PF15376
Interpro abstract (IPR027871):

This protein family is found in eukaryotes and has unknown function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4603