The domain within your query sequence starts at position 23 and ends at position 81; the E-value for the DUF4603 domain shown below is 2.4e-37.
GPVSVSDMSLLHALGPVQTWLGQELEKCGIDAMIYSRYILSLLLHDSYDYDLQEQVGID
DUF4603 |
---|
PFAM accession number: | PF15376 |
---|---|
Interpro abstract (IPR027871): | This protein family is found in eukaryotes and has unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4603