The domain within your query sequence starts at position 4 and ends at position 152; the E-value for the DUF4604 domain shown below is 6.9e-46.
RNQVSYVRPAEPAFLSRFKERVGYKEGPTVETKKIQPQLPDEDGNHSDKEDEQPQVVVLK KGDLTAEEVMKIKAEIKAAKTDEEPPPADGRIVYRKPVKRSSDEKCSGLTASSKKKKTNE DDVNKQSSVRKNSQKQIKNSSLLSFDSED
DUF4604 |
---|
PFAM accession number: | PF15377 |
---|---|
Interpro abstract (IPR027911): | This domain of unknown function is found in eukaryotes. It contains a conserved LSF sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4604