The domain within your query sequence starts at position 6 and ends at position 160; the E-value for the DUF4607 domain shown below is 6.8e-43.
QIIHNDSQPTNGPALRPFTAIGLCRSVSQNYSSQPISCKTSETVQEDKATASGSPTQTDS LTVCGSALGRGAVAITPETTLKHPHLPTERRPKAVISFPARVVKEPLPLLVGSSTRLFSK KLMKACSSVAPRPPQDFHKACSQSLSKPVVNTHTN
DUF4607 |
---|
PFAM accession number: | PF15380 |
---|---|
Interpro abstract (IPR029288): | This entry represents a group of a eukaryotic proteins that are typically between 207 and 359 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4607