The domain within your query sequence starts at position 63 and ends at position 130; the E-value for the DUF4609 domain shown below is 3.4e-42.
DKPETKQRSSKKRSVIPQIIITRASNETLISYGIPDNDEQRTIREHADWGPYHRHRSPST IAAYDVHN
DUF4609 |
---|
PFAM accession number: | PF15382 |
---|---|
Interpro abstract (IPR027930): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 70 and 139 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4609