The domain within your query sequence starts at position 102 and ends at position 221; the E-value for the DUF4615 domain shown below is 4e-41.
QLARELAWCVEQLELGLKTQRPTPKQKEQAVGAIRTLRSEKTPLPRKRQLMRSLFGDYRA QMDAEWREALRALKAATHSAQVQLVSEATRKKSGRVCRPRPAERAKTTPDLTSEEFRFNF
DUF4615 |
 |
|---|
| PFAM accession number: | PF15393 |
|---|---|
| Interpro abstract (IPR029274): | This entry represents a group of eukaryotic proteins that are typically between 161 and 229 amino acids in length. There is a single completely conserved residue F that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4615