The domain within your query sequence starts at position 451 and ends at position 1513; the E-value for the DUF4617 domain shown below is < 1e-12.

SMELLATCLSLWKNQPSKTTEENVPKPLEEKQCNTSRISTTVVGSANPTNEVHVKSLCSG
VGNSQKMMSSSQTVLPVLIPSCESSGVAVGKGTELQIAVVSPLVLSDTNTLPGKDSVPEV
LPETLYPVVKEGSVCSLQTQPTETVALPFDVIGAVASNNISAEIPLPVDKEKQHKPIQGD
PDIADSSLGKHSPLGTEVLPKPMDSTIVSGPMLQIESICSLAEGDVSYNSQIAEIFNSVQ
TEPQKPSPNQVIDSQQEQVYDTTENKDFSLQKDKCVQCTDVPHEVPEQPEPLQPEEPASS
EYVEANREATEESCREYTGRKESTAKDVCLPAAIQQDPHPRETDMFSKSDHSLPAINEIN
DESEPISYLHDQLSELLKEFPYGIETFNRHEVSLDQQKTHKIVENQTGGKTSNVSGDSTD
QIKITVLNSEQIKELFPEDDQPCDKLAEPENKEIVAEVKSPCDSQIPREESHDLGMLDPE
KDKIHCCALGWLSMVYEGVPQCHCSSTEKKEKDQCLDINSSKQGEQPCNSGITIFEINPV
SNNSKTPLTQATEEGHFSAVHGEKTKASKTKDNREGQELACHFSAKCYKKDKKGNFKIRH
DTSLKMEQKLKNISSKCDIPNPSKCNKIAAPEILHVTTSNSAKNMPFSKQASQESLQKKH
TSQDLGPVKAPIELSSNTDPCRSNTSSVQSVSPEKKKLKFKAGGSRLKYFEKRKTDHVII
PDVEIKKKKYEKQEQNKNAGDTLKLCSILTESNERASVQEKTVPSPESSDPKGSSSKSTR
VITVQEYLQRQKDKQITGNNASRNICVETVLCDSGHTKTSKHSAAVSWGKLVEGQSISAE
TAKELEHNSSSHGKDFKIHHSEASRTHSVSNNNKGKFDGKQPDKMFKNKTSMNNESNQMP
LQVKEQRKQYLNRVAFKCTERESICLTKLDSASKKLSIEKKSGEYTSKTKDTDKPSMLEF
KLCPDVLLKNTSTVDKQDCPGPGPEKEQAPVQVSGIKSTKEDWLKCIPTRTKMPESSQRD
SADSRLSKRSLSADEFEILQNPVKESNIMFRTYKKMYLEKRSR

DUF4617

DUF4617
PFAM accession number:PF15395
Interpro abstract (IPR027866):

This family of uncharacterised proteins is found in eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4617