The domain within your query sequence starts at position 1 and ends at position 65; the E-value for the DUF4619 domain shown below is 3.4e-26.
MGLGHSKAHPRVIKVTPLQSQETETPSTGPVFFALNRNLEEESSFTRLQDQNRTREGQLP PLRET
DUF4619 |
---|
PFAM accession number: | PF15398 |
---|---|
Interpro abstract (IPR029235): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 128 and 299 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4619