The domain within your query sequence starts at position 6 and ends at position 82; the E-value for the DUF4639 domain shown below is 1.4e-52.
SRQARDRGVTRSKAEKARPPTQPVPQVDIVPGRLNEAEWIAFMSLEEGEDVVGDILADLM TRVMECAFKVYLTQQVG
DUF4639 |
---|
PFAM accession number: | PF15479 |
---|---|
Interpro abstract (IPR028042): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 161 and 601 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4639