The domain within your query sequence starts at position 50 and ends at position 196; the E-value for the DUF4642 domain shown below is 1.1e-68.
CYRGHNHEEPLKTLCTGEGCVAANAEMDKPEDQDKVLMHFLNMGLPMKPSILVQKQSKEE MATSLGDNIKAEDYQKKQTYEPVNARETNHEGELAEKMPIHVHRSSDTGSQKRPLKGVTF SKEVIVVDLGNEYPTPRSYAREHKERK
DUF4642 |
---|
PFAM accession number: | PF15484 |
---|---|
Interpro abstract (IPR027813): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 115 and 196 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4642