The domain within your query sequence starts at position 6 and ends at position 166; the E-value for the DUF4644 domain shown below is 1.5e-93.
YAVSWAPGRPSHPDTPPNIYEGGLGAQQQQGPSAQGSKPKNFRLRHLRSLALYLPGHMQP AGQCGSHWLGRLMAGGSLTRPEGSPWPLDLPQGTLGPGNSHCSALLEAHLPRDSLGNTAS SSSMDPAKGVPSQSGPPEGLGLRPKRSWRALEETMCPLCKR
DUF4644 |
![]() |
---|
PFAM accession number: | PF15486 |
---|---|
Interpro abstract (IPR027978): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 143 and 191 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4644