The domain within your query sequence starts at position 558 and ends at position 1087; the E-value for the DUF4650 domain shown below is 1e-205.

VLSGAKGMVDSILPSALEETIQETASVSQVDSKDCLLEDKPVAGSAALVRVLAFQPQDSP
GSSGSSLVSSLCEGKLVAPCVDSSFPSQAVSTDLQAVLSQAGDTVVPNPVTDAPVPVLVQ
ELKSLATEKDSQTQLLPLKTEKLDPEQPGKSQASNLRKRETTASSKTVAARSAQNQPRKE
DQKRAFVGSWVKGLLSRGGAFMPTCVLSQSRAVSDLQPSVKGASNFDGFKTKSISRRSKR
MSRKAKHMEELSPRNSSPPLSWTAALTQAAENATSALLREQEGSRPAPLRHRSPGNESAI
SPASRGDAAEDQVHKLRLKLLKKLKAKKKKLAALISSPHREPSLSDHSEPASHCGTPASD
QSEPVSHCGSPNDCESIEDLLKELQHQIDLADSKSGCTSAPDATSNNSQSHEEILAELLS
PTAMSEPSESGELELRYLEMGDSTPAQAPSEFSVVSQNTCLKQDHDYCSPEKGQREVDLH
SVMDSACIRTLNLGSPMKTDIFDDFFSTSALNSLTNDTLDIPHFDDSLFE

DUF4650

DUF4650
PFAM accession number:PF15509
Interpro abstract (IPR029388):

This domain lies to the C terminus of the ubiquitin-specific peptidase-like proteins from veterbrates (IPR028890). Many peptidases require exosites (a secondary binding site that is remote from the active site) to recognise physiological substrates. This domain might be acting as the exosite for the peptidase.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4650