The domain within your query sequence starts at position 78 and ends at position 366; the E-value for the DUF4657 domain shown below is 1e-142.

MVVGDSSLATLSGLSQDSLNLEPMGSPELPPAQLDRLLARQKLEEVLERSREFPSLSAQR
GPLQLLNKPVDGVPIFAGEQESTEADTELEAGLEEAKEVGNMESAACTCLPGQGLRYLEH
LCLVLEQMVRLQQLYLQLQTQRPSRDPEEEVLAPALSSSHIPDNRVQEHREELSQTKDPE
GAEAASLPEVGVLVTSPSRLPEALLEPTHILPPSQEPKQDLSHWDKVKVLLNRLRWRSPR
LPEPPVPPDGSGSRMEFRNLSDRTPCHSQRKTFIPALVVKKPRAKNLSV

DUF4657

DUF4657
PFAM accession number:PF15552
Interpro abstract (IPR027958): This domain is found in eukaryotic proteins with a typical protein length of between 305 and 370 amino acids.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4657